PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00014.1.g05410.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 339aa    MW: 36327.2 Da    PI: 7.169
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00014.1.g05410.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.61e-31218273156
                         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                     k+r++W+peLH++Fv a++qLGG+++AtPk+i+e+m+v+gLt+++vkSHLQkYRl+
  Zjn_sc00014.1.g05410.1.sm.mkhc 218 KARRCWSPELHRQFVAALHQLGGPQVATPKQIREVMQVDGLTNDEVKSHLQKYRLH 273
                                     68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.744215275IPR017930Myb domain
SuperFamilySSF466892.33E-16216276IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28216276IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-25218273IPR006447Myb domain, plants
PfamPF002491.1E-7220271IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MGLDVGEIGV GLDLGLDLRL FAARSAGRMA AAVKGGPAAV DACIKSLEEE CKKIEMFRRE  60
LPLCARLLAD VIEELKEDAV KRGGDVASKA DDCDKRKWMS TAQLWVDSEA KSQESEKEQQ  120
SEITSPEPRL LGGAPMPLRA VAAPPPPPQF RTEGTVRQPG LAVLSPVVRR PLSPVPAGDE  180
HLQNQNVAAR FAATVPPSTP VLGLHAQTQQ QQQQQARKAR RCWSPELHRQ FVAALHQLGG  240
PQVATPKQIR EVMQVDGLTN DEVKSHLQKY RLHNRRSPDA APVTQQIVLV GGLWVPKEQG  300
SSQSGSPQGP LQFSGSGSGV AASVATVGGD HSSSDEDVV
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1056254e-58AK105625.1 Oryza sativa Japonica Group cDNA clone:001-200-C11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981657.11e-125PREDICTED: probable transcription factor GLK1
TrEMBLA0A059Q2Z51e-137A0A059Q2Z5_9POAL; DNA binding protein
STRINGSi036412m1e-124(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP181737107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-34G2-like family protein